PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G137300.1
Common NameB456_009G137300, LOC105769941
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 354aa    MW: 38172.7 Da    PI: 8.3887
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G137300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding422.1e-13110154347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ l++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qky
  Gorai.009G137300.1 110 PWTEEEHRLFLIGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKY 154
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.183103159IPR017930Myb domain
SuperFamilySSF466894.93E-17105160IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-18106158IPR006447Myb domain, plants
SMARTSM007172.6E-10107157IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-11107153IPR009057Homeodomain-like
PfamPF002496.5E-11110154IPR001005SANT/Myb domain
CDDcd001675.65E-9110155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RGGGGVGCGG VKLFGVRLTD GSIIKKSASM GNLSSAHYHS  60
SSSAAASPNP DSPSSDHVRD SNHVPDGYLS DEPTAHTSSN PRGERKKGVP WTEEEHRLFL  120
IGLQKLGKGD WRGIARNFVV SRTPTQVASH AQKYFIRQSN VTRRKRRSSL FDMVPNDMAT  180
DTPAVREEQV LPPSSRVEAD NSNSTPSLNL CLNSEFEHRD TAAQETVKGT EETMMVSSGY  240
TPIVHSFISP YAPVAYPFWP PNLAPNDEGK GIEASQHQVL KPVPMFPKEP VNVDELVGMS  300
QLCIGESEKG HREPSPLSLK LLGEPSRQSA FHANAPVGAT DLGKGKTGVI QAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446375.10.0PREDICTED: uncharacterized protein LOC105769941
TrEMBLA0A0D2TPP10.0A0A0D2TPP1_G
STRINGGLYMA13G43120.11e-156(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93132735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.14e-98MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]